PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g14350
Common NameGSCOC_T00036625001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 253aa    MW: 27707 Da    PI: 7.6645
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g14350genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.82e-3150103357
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                  k rY+eClkNhA+ +GghavDGCgEf+++ g+egt +alkCaAC+CHRnFHR+e 
  Cc07_g14350  50 KPRYRECLKNHAVGIGGHAVDGCGEFLAA-GAEGTLDALKCAACNCHRNFHRKEA 103
                  779*************************9.999********************96 PP

2Homeobox16.31.7e-05190245152
                  TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                  +r Rt+f++eq e + +l e    k ++ ++e  ++L ++lg++ ++ kvW +N +
  Cc07_g14350 190 KRFRTKFSQEQKEKMSDLAEklgwKIQKQDEEVVQQLCNELGIKRQVLKVWMHNNK 245
                  789************99999776678999*************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2334103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.7E-2952102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.3E-2852102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.92653102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.84E-20176250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-31184251IPR009057Homeodomain-like
PROSITE profilePS500718.794187251IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-26189245IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MEFEDQEENE GVEMELGPSY DSLGNSNSTR VSNKVPSPVE MSAEPTSQRK PRYRECLKNH  60
AVGIGGHAVD GCGEFLAAGA EGTLDALKCA ACNCHRNFHR KEALPGLPPH DPFHLYHHHY  120
HQQPPPPPPQ LLTYRTPSGY LHVSPPQQNR PLALPSISGG GEHEDMSNMN TSGGGGSGGG  180
GGGFVGSSKK RFRTKFSQEQ KEKMSDLAEK LGWKIQKQDE EVVQQLCNEL GIKRQVLKVW  240
MHNNKHTLGK KP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A7e-231892471775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012469839.13e-92PREDICTED: zinc-finger homeodomain protein 2 isoform X1
SwissprotA2Z2592e-67ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLA0A068U0310.0A0A068U031_COFCA; Uncharacterized protein
STRINGGLYMA02G04550.29e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.19e-60homeobox protein 22